UBLCP1 antibody (70R-3747)

Rabbit polyclonal UBLCP1 antibody raised against the N terminal of UBLCP1

Synonyms Polyclonal UBLCP1 antibody, Anti-UBLCP1 antibody, MGC10067 antibody, UBLCP 1, CPUB1 antibody, UBLCP1, UBLCP-1, UBLCP 1 antibody, Ubiquitin-Like Domain Containing Ctd Phosphatase 1 antibody, UBLCP-1 antibody, FLJ25267 antibody
Specificity UBLCP1 antibody was raised against the N terminal of UBLCP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UBLCP1 antibody was raised using the N terminal of UBLCP1 corresponding to a region with amino acids MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV
Assay Information UBLCP1 Blocking Peptide, catalog no. 33R-5694, is also available for use as a blocking control in assays to test for specificity of this UBLCP1 antibody

Images

Western Blot analysis using UBLCP1 antibody (70R-3747)

UBLCP1 antibody (70R-3747) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBLCP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBLCP1 may specifically dephosphorylate 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UBLCP1 antibody (70R-3747) | UBLCP1 antibody (70R-3747) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors