UBXD3 antibody (70R-4548)

Rabbit polyclonal UBXD3 antibody raised against the middle region of UBXD3

Synonyms Polyclonal UBXD3 antibody, Anti-UBXD3 antibody, FLJ25429 antibody, UBXD 3, UBXD 3 antibody, UBXD3, Ubx Domain Protein 10 antibody, UBXD-3 antibody, UBXD-3
Specificity UBXD3 antibody was raised against the middle region of UBXD3
Cross Reactivity Human
Applications WB
Immunogen UBXD3 antibody was raised using the middle region of UBXD3 corresponding to a region with amino acids PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI
Assay Information UBXD3 Blocking Peptide, catalog no. 33R-7443, is also available for use as a blocking control in assays to test for specificity of this UBXD3 antibody


Western Blot analysis using UBXD3 antibody (70R-4548)

UBXD3 antibody (70R-4548) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBXD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of UBXD3 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UBXD3 antibody (70R-4548) | UBXD3 antibody (70R-4548) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors