UCHL5 antibody (70R-3208)

Rabbit polyclonal UCHL5 antibody raised against the middle region of UCHL5

Synonyms Polyclonal UCHL5 antibody, Anti-UCHL5 antibody, UCH37 antibody, UCHL 5 antibody, UCHL-5, UCHL 5, CGI-70 antibody, UCHL-5 antibody, UCHL5, Ubiquitin Carboxyl-Terminal Hydrolase L5 antibody
Specificity UCHL5 antibody was raised against the middle region of UCHL5
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen UCHL5 antibody was raised using the middle region of UCHL5 corresponding to a region with amino acids DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK
Assay Information UCHL5 Blocking Peptide, catalog no. 33R-1959, is also available for use as a blocking control in assays to test for specificity of this UCHL5 antibody


Western Blot analysis using UCHL5 antibody (70R-3208)

UCHL5 antibody (70R-3208) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UCHL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UCHL5 is the deubiquitinating enzyme associated with the proteasome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UCHL5 antibody (70R-3208) | UCHL5 antibody (70R-3208) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors