UCRC antibody (70R-7221)

Rabbit polyclonal UCRC antibody

Synonyms Polyclonal UCRC antibody, Anti-UCRC antibody, HSPC051 antibody, Ubiquinol-Cytochrome C Reductase Complex antibody, HSPC151 antibody, HSPC119 antibody
Cross Reactivity Human
Applications WB
Immunogen UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Assay Information UCRC Blocking Peptide, catalog no. 33R-4946, is also available for use as a blocking control in assays to test for specificity of this UCRC antibody

Images

Western Blot analysis using UCRC antibody (70R-7221)

UCRC antibody (70R-7221) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 7 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UCRC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UCRC antibody (70R-7221) | UCRC antibody (70R-7221) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors