UEVLD antibody (70R-3480)

Rabbit polyclonal UEVLD antibody raised against the N terminal of UEVLD

Synonyms Polyclonal UEVLD antibody, Anti-UEVLD antibody, FLJ11068 antibody, ATTP antibody, UEV3 antibody, Uev And Lactate/Malate Dehyrogenase Domains antibody
Specificity UEVLD antibody was raised against the N terminal of UEVLD
Cross Reactivity Human
Applications WB
Immunogen UEVLD antibody was raised using the N terminal of UEVLD corresponding to a region with amino acids FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP
Assay Information UEVLD Blocking Peptide, catalog no. 33R-2953, is also available for use as a blocking control in assays to test for specificity of this UEVLD antibody

Images

Western Blot analysis using UEVLD antibody (70R-3480)

UEVLD antibody (70R-3480) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UEVLD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UEVLD is a possible negative regulator of polyubiquitination.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UEVLD antibody (70R-3480) | UEVLD antibody (70R-3480) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors