UGCG antibody (70R-7359)

Rabbit polyclonal UGCG antibody raised against the N terminal of UGCG

Synonyms Polyclonal UGCG antibody, Anti-UGCG antibody, GCS antibody, Udp-Glucose Ceramide Glucosyltransferase antibody
Specificity UGCG antibody was raised against the N terminal of UGCG
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UGCG antibody was raised using the N terminal of UGCG corresponding to a region with amino acids LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL
Assay Information UGCG Blocking Peptide, catalog no. 33R-5018, is also available for use as a blocking control in assays to test for specificity of this UGCG antibody

Images

Western Blot analysis using UGCG antibody (70R-7359)

UGCG antibody (70R-7359) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGCG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UGCG antibody (70R-7359) | UGCG antibody (70R-7359) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors