UGCGL2 antibody (70R-5339)

Rabbit polyclonal UGCGL2 antibody raised against the N terminal of UGCGL2

Synonyms Polyclonal UGCGL2 antibody, Anti-UGCGL2 antibody, MGC150689 antibody, UGCGL-2, UGCGL 2 antibody, MGC87276 antibody, UGCGL 2, Udp-Glucose Ceramide Glucosyltransferase-Like 2 antibody, MGC117360 antibody, UGCGL2, UGCGL-2 antibody, HUGT2 antibody, FLJ11485 antibody, FLJ10873 antibody
Specificity UGCGL2 antibody was raised against the N terminal of UGCGL2
Cross Reactivity Human
Applications WB
Immunogen UGCGL2 antibody was raised using the N terminal of UGCGL2 corresponding to a region with amino acids KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR
Assay Information UGCGL2 Blocking Peptide, catalog no. 33R-4422, is also available for use as a blocking control in assays to test for specificity of this UGCGL2 antibody

Images

Western Blot analysis using UGCGL2 antibody (70R-5339)

UGCGL2 antibody (70R-5339) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 172 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGCGL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UGCGL2 antibody (70R-5339) | UGCGL2 antibody (70R-5339) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors