UGP2 antibody (70R-4104)

Rabbit polyclonal UGP2 antibody raised against the N terminal of UGP2

Synonyms Polyclonal UGP2 antibody, Anti-UGP2 antibody, UGP-2 antibody, UGP-2, UGPP2 antibody, UDPGP2 antibody, UDPG antibody, pHC379 antibody, Udp-Glucose Pyrophosphorylase 2 antibody, UGP2, UGP 2, UGP 2 antibody
Specificity UGP2 antibody was raised against the N terminal of UGP2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen UGP2 antibody was raised using the N terminal of UGP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN
Assay Information UGP2 Blocking Peptide, catalog no. 33R-9141, is also available for use as a blocking control in assays to test for specificity of this UGP2 antibody


Western Blot analysis using UGP2 antibody (70R-4104)

UGP2 antibody (70R-4104) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UGP2 antibody (70R-4104) | UGP2 antibody (70R-4104) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors