UGT1A1 antibody (70R-1876)

Rabbit polyclonal UGT1A1 antibody raised against the middle region of UGT1A1

Synonyms Polyclonal UGT1A1 antibody, Anti-UGT1A1 antibody, UGT1A antibody, UDPGT antibody, UGT1A1, UGTA 1, GNT1 antibody, Udp Glucuronosyltransferase 1 Family Polypeptide A1 antibody, UGT1 antibody, HUG-BR1 antibody, UGTA-1 antibody, UGTA 1 antibody, UGTA-1
Specificity UGT1A1 antibody was raised against the middle region of UGT1A1
Cross Reactivity Human
Applications WB
Immunogen UGT1A1 antibody was raised using the middle region of UGT1A1 corresponding to a region with amino acids ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH
Assay Information UGT1A1 Blocking Peptide, catalog no. 33R-1543, is also available for use as a blocking control in assays to test for specificity of this UGT1A1 antibody

Images

Western Blot analysis using UGT1A1 antibody (70R-1876)

UGT1A1 antibody (70R-1876) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UGT1A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UGT1A1 antibody (70R-1876) | UGT1A1 antibody (70R-1876) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors