UGT1A4 antibody (70R-7257)

Rabbit polyclonal UGT1A4 antibody raised against the N terminal of UGT1A4

Synonyms Polyclonal UGT1A4 antibody, Anti-UGT1A4 antibody, UGTA4-1 antibody, UGT1D antibody, UGT1A4, UGTA4-1, HUG-BR2 antibody, UGTA4 1, UGTA4 1 antibody, UDPGT antibody, Udp Glucuronosyltransferase 1 Family Polypeptide A4 antibody
Specificity UGT1A4 antibody was raised against the N terminal of UGT1A4
Cross Reactivity Human
Applications WB
Immunogen UGT1A4 antibody was raised using the N terminal of UGT1A4 corresponding to a region with amino acids VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK
Assay Information UGT1A4 Blocking Peptide, catalog no. 33R-9886, is also available for use as a blocking control in assays to test for specificity of this UGT1A4 antibody

Images

Western Blot analysis using UGT1A4 antibody (70R-7257)

UGT1A4 antibody (70R-7257) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGT1A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UGT1A4 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UGT1A4 antibody (70R-7257) | UGT1A4 antibody (70R-7257) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors