UGT1A6 antibody (70R-7546)

Rabbit polyclonal UGT1A6 antibody raised against the C terminal of UGT1A6

Synonyms Polyclonal UGT1A6 antibody, Anti-UGT1A6 antibody, Udp Glucuronosyltransferase 1 Family Polypeptide A6 antibody, UDPGT antibody, UGTA6-1 antibody, MGC29860 antibody, UGT1F antibody, UGTA6 1 antibody, HLUGP1 antibody, UGTA6-1, UGTA6 1, GNT1 antibody, HLUGP antibody, UGT1A6, UGT1 antibody
Specificity UGT1A6 antibody was raised against the C terminal of UGT1A6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UGT1A6 antibody was raised using the C terminal of UGT1A6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK
Assay Information UGT1A6 Blocking Peptide, catalog no. 33R-1424, is also available for use as a blocking control in assays to test for specificity of this UGT1A6 antibody


Western Blot analysis using UGT1A6 antibody (70R-7546)

UGT1A6 antibody (70R-7546) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGT1A6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UGT1A6 antibody (70R-7546) | UGT1A6 antibody (70R-7546) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors