UGT1A7 antibody (70R-7305)

Rabbit polyclonal UGT1A7 antibody raised against the N terminal of UGT1A7

Synonyms Polyclonal UGT1A7 antibody, Anti-UGT1A7 antibody, UGT1G antibody, UGTA7-1 antibody, UGT1A7, UGTA7-1, Udp Glucuronosyltransferase 1 Family Polypeptide A7 antibody, UDPGT antibody, UGTA7 1, UGTA7 1 antibody
Specificity UGT1A7 antibody was raised against the N terminal of UGT1A7
Cross Reactivity Human
Applications WB
Immunogen UGT1A7 antibody was raised using the N terminal of UGT1A7 corresponding to a region with amino acids VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
Assay Information UGT1A7 Blocking Peptide, catalog no. 33R-9639, is also available for use as a blocking control in assays to test for specificity of this UGT1A7 antibody

Images

Western Blot analysis using UGT1A7 antibody (70R-7305)

UGT1A7 antibody (70R-7305) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGT1A7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UGT1A7 antibody (70R-7305) | UGT1A7 antibody (70R-7305) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors