UGT2A3 antibody (70R-7441)

Rabbit polyclonal UGT2A3 antibody raised against the N terminal of UGT2A3

Synonyms Polyclonal UGT2A3 antibody, Anti-UGT2A3 antibody, Udp Glucuronosyltransferase 2 Family Polypeptide A3 antibody, UGTA3-2 antibody, UGTA3-2, FLJ21934 antibody, UGT2A3, UGTA3 2 antibody, UGTA3 2
Specificity UGT2A3 antibody was raised against the N terminal of UGT2A3
Cross Reactivity Human
Applications WB
Immunogen UGT2A3 antibody was raised using the N terminal of UGT2A3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN
Assay Information UGT2A3 Blocking Peptide, catalog no. 33R-6917, is also available for use as a blocking control in assays to test for specificity of this UGT2A3 antibody


Western Blot analysis using UGT2A3 antibody (70R-7441)

UGT2A3 antibody (70R-7441) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGT2A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UGT2A3 antibody (70R-7441) | UGT2A3 antibody (70R-7441) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors