UGT2B15 antibody (70R-7532)

Rabbit polyclonal UGT2B15 antibody raised against the N terminal of UGT2B15

Synonyms Polyclonal UGT2B15 antibody, Anti-UGT2B15 antibody, UGTB15-2, UGTB15 2 antibody, UGT2B8 antibody, UGTB15 2, UGTB15-2 antibody, Udp Glucuronosyltransferase 2 Family Polypeptide B15 antibody, UGT2B15
Specificity UGT2B15 antibody was raised against the N terminal of UGT2B15
Cross Reactivity Human
Applications WB
Immunogen UGT2B15 antibody was raised using the N terminal of UGT2B15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY
Assay Information UGT2B15 Blocking Peptide, catalog no. 33R-4025, is also available for use as a blocking control in assays to test for specificity of this UGT2B15 antibody

Images

Western Blot analysis using UGT2B15 antibody (70R-7532)

UGT2B15 antibody (70R-7532) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGT2B15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UGT2B15 antibody (70R-7532) | UGT2B15 antibody (70R-7532) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors