ULBP1 antibody (70R-5981)

Rabbit polyclonal ULBP1 antibody raised against the N terminal of ULBP1

Synonyms Polyclonal ULBP1 antibody, Anti-ULBP1 antibody, RAET1I antibody, ULBP 1, Ul16 Binding Protein 1 antibody, ULBP-1, ULBP1, ULBP 1 antibody, ULBP-1 antibody
Specificity ULBP1 antibody was raised against the N terminal of ULBP1
Cross Reactivity Human
Applications WB
Immunogen ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC
Assay Information ULBP1 Blocking Peptide, catalog no. 33R-5583, is also available for use as a blocking control in assays to test for specificity of this ULBP1 antibody

Images

Western Blot analysis using ULBP1 antibody (70R-5981)

ULBP1 antibody (70R-5981) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ULBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ULBP1 is the ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ULBP1 antibody (70R-5981) | ULBP1 antibody (70R-5981) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors