UNC5A antibody (70R-6957)

Rabbit polyclonal UNC5A antibody

Synonyms Polyclonal UNC5A antibody, Anti-UNC5A antibody, KIAA1976 antibody, UNCA 5 antibody, UNCA-5 antibody, UNCA 5, UNC5H1 antibody, FLJ16449 antibody, Unc-5 Homolog A antibody, UNCA-5, UNC5A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UNC5A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
Assay Information UNC5A Blocking Peptide, catalog no. 33R-9915, is also available for use as a blocking control in assays to test for specificity of this UNC5A antibody

Images

Western Blot analysis using UNC5A antibody (70R-6957)

UNC5A antibody (70R-6957) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UNC5A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UNC5A antibody (70R-6957) | UNC5A antibody (70R-6957) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors