UNC5C antibody (70R-7135)

Rabbit polyclonal UNC5C antibody

Synonyms Polyclonal UNC5C antibody, Anti-UNC5C antibody, UNCC-5 antibody, UNCC 5 antibody, UNCC-5, UNC5H3 antibody, Unc-5 Homolog C antibody, UNCC 5, UNC5C
Cross Reactivity Human
Applications WB
Immunogen UNC5C antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS
Assay Information UNC5C Blocking Peptide, catalog no. 33R-9901, is also available for use as a blocking control in assays to test for specificity of this UNC5C antibody


Western Blot analysis using UNC5C antibody (70R-7135)

UNC5C antibody (70R-7135) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UNC5C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UNC5C antibody (70R-7135) | UNC5C antibody (70R-7135) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors