UNC84A antibody (70R-6253)

Rabbit polyclonal UNC84A antibody

Synonyms Polyclonal UNC84A antibody, Anti-UNC84A antibody, MGC176649 antibody, Unc-84 Homolog A antibody, SUN1 antibody, KIAA0810 antibody, UNCA-84, UNC84A, UNCA 84 antibody, UNCA-84 antibody, UNCA 84, FLJ12407 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UNC84A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA
Assay Information UNC84A Blocking Peptide, catalog no. 33R-7492, is also available for use as a blocking control in assays to test for specificity of this UNC84A antibody

Images

Western Blot analysis using UNC84A antibody (70R-6253)

UNC84A antibody (70R-6253) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UNC84A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UNC84A antibody (70R-6253) | UNC84A antibody (70R-6253) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors