UNC84B antibody (70R-5701)

Rabbit polyclonal UNC84B antibody

Synonyms Polyclonal UNC84B antibody, Anti-UNC84B antibody, UNCB-84 antibody, UNCB 84, UNC84B, UNCB-84, SUN2 antibody, UNCB 84 antibody, MGC133056 antibody, KIAA0668 antibody, MGC133055 antibody, Unc-84 Homolog B antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen UNC84B antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM
Assay Information UNC84B Blocking Peptide, catalog no. 33R-8772, is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody

Images

Western Blot analysis using UNC84B antibody (70R-5701)

UNC84B antibody (70R-5701) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UNC84B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UNC84B may form a physical interaction between the nuclear envelope and the centrosome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UNC84B antibody (70R-5701) | UNC84B antibody (70R-5701) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors