UNC84B antibody (70R-6991)

Rabbit polyclonal UNC84B antibody

Synonyms Polyclonal UNC84B antibody, Anti-UNC84B antibody, UNCB 84, MGC133056 antibody, UNCB-84 antibody, UNCB-84, SUN2 antibody, Unc-84 Homolog B antibody, MGC133055 antibody, KIAA0668 antibody, UNCB 84 antibody, RP3-508I15.15 antibody, UNC84B
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen UNC84B antibody was raised using a synthetic peptide corresponding to a region with amino acids CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG
Assay Information UNC84B Blocking Peptide, catalog no. 33R-1831, is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody

Images

Western Blot analysis using UNC84B antibody (70R-6991)

UNC84B antibody (70R-6991) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UNC84B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UNC84B plays a role in mitotic spindle organization and biogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UNC84B antibody (70R-6991) | UNC84B antibody (70R-6991) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors