UPF1 antibody (70R-4618)

Rabbit polyclonal UPF1 antibody

Synonyms Polyclonal UPF1 antibody, Anti-UPF1 antibody, HUPF1 antibody, UPF-1 antibody, NORF1 antibody, pNORF1 antibody, FLJ46894 antibody, KIAA0221 antibody, UPF 1, RENT1 antibody, UPF 1 antibody, UPF-1, FLJ43809 antibody, UPF1, Upf1 Regulator Of Nonsense Transcripts Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen UPF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG
Assay Information UPF1 Blocking Peptide, catalog no. 33R-7945, is also available for use as a blocking control in assays to test for specificity of this UPF1 antibody


Western Blot analysis using UPF1 antibody (70R-4618)

UPF1 antibody (70R-4618) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 123 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UPF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UPF1 antibody (70R-4618) | UPF1 antibody (70R-4618) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors