UPP1 antibody (70R-3171)

Rabbit polyclonal UPP1 antibody raised against the middle region of UPP1

Synonyms Polyclonal UPP1 antibody, Anti-UPP1 antibody, UPP antibody, Uridine Phosphorylase 1 antibody, UP antibody, UPP1, UPASE antibody, UDRPASE antibody, UPP 1 antibody, UPP-1, UPP-1 antibody, UPP 1
Specificity UPP1 antibody was raised against the middle region of UPP1
Cross Reactivity Human
Applications WB
Immunogen UPP1 antibody was raised using the middle region of UPP1 corresponding to a region with amino acids ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK
Assay Information UPP1 Blocking Peptide, catalog no. 33R-1068, is also available for use as a blocking control in assays to test for specificity of this UPP1 antibody

Images

Western Blot analysis using UPP1 antibody (70R-3171)

UPP1 antibody (70R-3171) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UPP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UPP1 antibody (70R-3171) | UPP1 antibody (70R-3171) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors