UQCRFS1 antibody (70R-5972)

Rabbit polyclonal UQCRFS1 antibody raised against the N terminal of UQCRFS1

Synonyms Polyclonal UQCRFS1 antibody, Anti-UQCRFS1 antibody, Ubiquinol-Cytochrome C Reductase Rieske Iron-Sulfur Polypeptide 1 antibody, rip1 antibody, UQCRFS 1, UQCRFS-1 antibody, UQCRFS 1 antibody, uqcr5 antibody, RIS1 antibody, UQCRFS1, risp antibody, UQCRFS-1
Specificity UQCRFS1 antibody was raised against the N terminal of UQCRFS1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL
Assay Information UQCRFS1 Blocking Peptide, catalog no. 33R-6220, is also available for use as a blocking control in assays to test for specificity of this UQCRFS1 antibody

Images

Western Blot analysis using UQCRFS1 antibody (70R-5972)

UQCRFS1 antibody (70R-5972) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UQCRFS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UQCRFS1 antibody (70R-5972) | UQCRFS1 antibody (70R-5972) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors