URG4 antibody (70R-2224)

Rabbit polyclonal URG4 antibody raised against the middle region of URG4

Synonyms Polyclonal URG4 antibody, Anti-URG4 antibody, Up-Regulated Gene 4 antibody, DKFZp686O0457 antibody, DKFZp666G166 antibody, URG4, URG-4, URG 4, URG-4 antibody, URG 4 antibody
Specificity URG4 antibody was raised against the middle region of URG4
Cross Reactivity Human
Applications WB
Immunogen URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR
Assay Information URG4 Blocking Peptide, catalog no. 33R-1272, is also available for use as a blocking control in assays to test for specificity of this URG4 antibody

Images

Western Blot analysis using URG4 antibody (70R-2224)

URG4 antibody (70R-2224) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of URG4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using URG4 antibody (70R-2224) | URG4 antibody (70R-2224) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors