USP48 antibody (70R-1774)
Rabbit polyclonal USP48 antibody raised against the middle region of USP48
Overview
Overview
Synonyms | Polyclonal USP48 antibody, Anti-USP48 antibody, USP-48 antibody, USP48, USP 48, Ubiquitin Specific Peptidase 48 antibody, USP-48, USP 48 antibody |
---|---|
Specificity | USP48 antibody was raised against the middle region of USP48 |
Cross Reactivity | Human,Mouse,Rat,Dog |
Applications | WB |
Immunogen | USP48 antibody was raised using the middle region of USP48 corresponding to a region with amino acids ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV |
Assay Information | USP48 Blocking Peptide, catalog no. 33R-1333, is also available for use as a blocking control in assays to test for specificity of this USP48 antibody |
Images
Western Blot analysis using USP48 antibody (70R-1774)
USP48 antibody (70R-1774) used at 2.5 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Total IgG Protein A purified |
Molecular Weight | 70 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of USP48 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 2.5 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product