USP48 antibody (70R-6673)

Rabbit polyclonal USP48 antibody raised against the C terminal of USP48

Synonyms Polyclonal USP48 antibody, Anti-USP48 antibody, MGC14879 antibody, USP31 antibody, Ubiquitin Specific Peptidase 48 antibody, USP-48 antibody, RAP1GA1 antibody, MGC132556 antibody, USP48, USP 48, DKFZp762M1713 antibody, USP-48, USP 48 antibody
Specificity USP48 antibody was raised against the C terminal of USP48
Cross Reactivity Human,Dog
Applications WB
Immunogen USP48 antibody was raised using the C terminal of USP48 corresponding to a region with amino acids PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS
Assay Information USP48 Blocking Peptide, catalog no. 33R-7311, is also available for use as a blocking control in assays to test for specificity of this USP48 antibody

Images

Western Blot analysis using USP48 antibody (70R-6673)

USP48 antibody (70R-6673) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of USP48 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using USP48 antibody (70R-6673) | USP48 antibody (70R-6673) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors