UTP14A antibody (70R-4460)

Rabbit polyclonal UTP14A antibody

Synonyms Polyclonal UTP14A antibody, Anti-UTP14A antibody, UTPA 14 antibody, NY-CO-16 antibody, UTPA 14, UTPA-14, dJ537K23.3 antibody, KIAA0266 antibody, UTP14A, UTPA-14 antibody, Utp14 U3 Small Nucleolar Ribonucleoprotein Homolog A antibody, SDCCAG16 antibody
Cross Reactivity Human
Applications WB
Immunogen UTP14A antibody was raised using a synthetic peptide corresponding to a region with amino acids KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL
Assay Information UTP14A Blocking Peptide, catalog no. 33R-4729, is also available for use as a blocking control in assays to test for specificity of this UTP14A antibody

Images

Western Blot analysis using UTP14A antibody (70R-4460)

UTP14A antibody (70R-4460) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UTP14A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UTP14A antibody (70R-4460) | UTP14A antibody (70R-4460) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors