UXS1 antibody (70R-7443)

Rabbit polyclonal UXS1 antibody raised against the middle region of UXS1

Synonyms Polyclonal UXS1 antibody, Anti-UXS1 antibody, UXS 1, FLJ23591 antibody, UXS 1 antibody, UXS1, UXS-1, UGD antibody, Udp-Glucuronate Decarboxylase 1 antibody, UXS-1 antibody
Specificity UXS1 antibody was raised against the middle region of UXS1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH
Assay Information UXS1 Blocking Peptide, catalog no. 33R-5205, is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody

Images

Western Blot analysis using UXS1 antibody (70R-7443)

UXS1 antibody (70R-7443) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UXS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UXS1 antibody (70R-7443) | UXS1 antibody (70R-7443) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors