VAMP5 antibody (70R-1760)

Rabbit polyclonal VAMP5 antibody

Synonyms Polyclonal VAMP5 antibody, Anti-VAMP5 antibody, VAMP5, VAMP 5, VAMP-5 antibody, Myobrevin antibody, Vesicle-Associated Membrane Protein 5 antibody, VAMP-5, VAMP 5 antibody
Cross Reactivity Human
Applications WB
Immunogen VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
Assay Information VAMP5 Blocking Peptide, catalog no. 33R-4142, is also available for use as a blocking control in assays to test for specificity of this VAMP5 antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of VAMP5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Synaptobrevins/VAMPs, syntaxins, and the 25 kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. VAMP5 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors