VARS antibody (70R-3183)

Rabbit polyclonal VARS antibody raised against the middle region of VARS

Synonyms Polyclonal VARS antibody, Anti-VARS antibody, G7A antibody, Valyl-tRNA Synthetase antibody, VARS2 antibody
Specificity VARS antibody was raised against the middle region of VARS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP
Assay Information VARS Blocking Peptide, catalog no. 33R-9521, is also available for use as a blocking control in assays to test for specificity of this VARS antibody


Western Blot analysis using VARS antibody (70R-3183)

VARS antibody (70R-3183) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 140 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using VARS antibody (70R-3183) | VARS antibody (70R-3183) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors