Vasohibin 1 antibody (70R-2056)

Rabbit polyclonal Vasohibin 1 antibody raised against the N terminal of VASH1

Synonyms Polyclonal Vasohibin 1 antibody, Anti-Vasohibin 1 antibody, Vasohibin -1, Vasohibin 1 antibody, KIAA1036 antibody, Vasohibin 1, Vasohibin 1, Vasohibin -1 antibody, VASH1 antibody
Specificity Vasohibin 1 antibody was raised against the N terminal of VASH1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Vasohibin 1 antibody was raised using the N terminal of VASH1 corresponding to a region with amino acids ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER
Assay Information Vasohibin 1 Blocking Peptide, catalog no. 33R-1576, is also available for use as a blocking control in assays to test for specificity of this Vasohibin 1 antibody


Western Blot analysis using Vasohibin 1 antibody (70R-2056)

Vasohibin 1 antibody (70R-2056) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VASH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Vasohibin 1 antibody (70R-2056) | Vasohibin 1 antibody (70R-2056) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors