VAT1 antibody (70R-4508)

Rabbit polyclonal VAT1 antibody

Synonyms Polyclonal VAT1 antibody, Anti-VAT1 antibody, VAT 1, VAT1, VAT-1, VATI antibody, VAT-1 antibody, FLJ20230 antibody, Vesicle Amine Transport Protein 1 Homolog antibody, VAT 1 antibody
Cross Reactivity Human
Applications WB
Immunogen VAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA
Assay Information VAT1 Blocking Peptide, catalog no. 33R-7240, is also available for use as a blocking control in assays to test for specificity of this VAT1 antibody

Images

Western Blot analysis using VAT1 antibody (70R-4508)

VAT1 antibody (70R-4508) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VAT1 antibody (70R-4508) | VAT1 antibody (70R-4508) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors