VDAC1 antibody (70R-1541)

Rabbit polyclonal VDAC1 antibody raised against the C terminal of VDAC1

Synonyms Polyclonal VDAC1 antibody, Anti-VDAC1 antibody, VDAC 1, VDAC 1 antibody, VDAC-1, Voltage-Dependent Anion Channel 1 antibody, VDAC-1 antibody, VDAC1
Specificity VDAC1 antibody was raised against the C terminal of VDAC1
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Assay Information VDAC1 Blocking Peptide, catalog no. 33R-8303, is also available for use as a blocking control in assays to test for specificity of this VDAC1 antibody


Immunohistochemical staining using VDAC1 antibody (70R-1541)

VDAC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of VDAC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using VDAC1 antibody (70R-1541) | VDAC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using VDAC1 antibody (70R-1541) | VDAC1 antibody (70R-1541) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors