VDAC2 antibody (70R-5052)

Rabbit polyclonal VDAC2 antibody raised against the N terminal of VDAC2

Synonyms Polyclonal VDAC2 antibody, Anti-VDAC2 antibody, VDAC-2 antibody, VDAC2, VDAC 2, Voltage-Dependent Anion Channel 2 antibody, FLJ23841 antibody, VDAC-2, VDAC 2 antibody
Specificity VDAC2 antibody was raised against the N terminal of VDAC2
Cross Reactivity Human
Applications WB
Immunogen VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN
Assay Information VDAC2 Blocking Peptide, catalog no. 33R-9629, is also available for use as a blocking control in assays to test for specificity of this VDAC2 antibody

Images

Western Blot analysis using VDAC2 antibody (70R-5052)

VDAC2 antibody (70R-5052) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VDAC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VDAC2 antibody (70R-5052) | VDAC2 antibody (70R-5052) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors