VDR antibody (70R-1930)

Rabbit polyclonal VDR antibody raised against the N terminal of VDR

Synonyms Polyclonal VDR antibody, Anti-VDR antibody, NR1I1 antibody, Vitamin D 125- Dihydroxyvitamin D3 Receptor antibody
Specificity VDR antibody was raised against the N terminal of VDR
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen VDR antibody was raised using the N terminal of VDR corresponding to a region with amino acids ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP
Assay Information VDR Blocking Peptide, catalog no. 33R-4052, is also available for use as a blocking control in assays to test for specificity of this VDR antibody


Western Blot analysis using VDR antibody (70R-1930)

VDR antibody (70R-1930) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VDR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VDR is the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarit

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using VDR antibody (70R-1930) | VDR antibody (70R-1930) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors