VGF antibody (70R-6218)

Rabbit polyclonal VGF antibody raised against the middle region of VGF

Synonyms Polyclonal VGF antibody, Anti-VGF antibody, Vgf Nerve Growth Factor Inducible antibody
Specificity VGF antibody was raised against the middle region of VGF
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM
Assay Information VGF Blocking Peptide, catalog no. 33R-1490, is also available for use as a blocking control in assays to test for specificity of this VGF antibody

Images

Western Blot analysis using VGF antibody (70R-6218)

VGF antibody (70R-6218) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VGF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VGF antibody (70R-6218) | VGF antibody (70R-6218) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors