VIP antibody (70R-6661)

Rabbit polyclonal VIP antibody raised against the middle region of VIP

Synonyms Polyclonal VIP antibody, Anti-VIP antibody, PHM27 antibody, MGC13587 antibody, Vasoactive Intestinal Peptide antibody
Specificity VIP antibody was raised against the middle region of VIP
Cross Reactivity Human
Applications WB
Immunogen VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE
Assay Information VIP Blocking Peptide, catalog no. 33R-9742, is also available for use as a blocking control in assays to test for specificity of this VIP antibody

Images

Western Blot analysis using VIP antibody (70R-6661)

VIP antibody (70R-6661) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 3 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VIP antibody (70R-6661) | VIP antibody (70R-6661) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors