VMD2L2 antibody (70R-1494)

Rabbit polyclonal VMD2L2 antibody raised against the N terminal Of Vmd2L2

Synonyms Polyclonal VMD2L2 antibody, Anti-VMD2L2 antibody, VMDL 2 antibody, VMDL-2 antibody, VMDL 2, Vitelliform Macular Dystrophy 2-like 2 antibody, VMD2L2, VMDL-2
Specificity VMD2L2 antibody was raised against the N terminal Of Vmd2L2
Cross Reactivity Human,Dog
Applications WB
Immunogen VMD2L2 antibody was raised using the N terminal Of Vmd2L2 corresponding to a region with amino acids MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY
Assay Information VMD2L2 Blocking Peptide, catalog no. 33R-6572, is also available for use as a blocking control in assays to test for specificity of this VMD2L2 antibody

Images

Western Blot analysis using VMD2L2 antibody (70R-1494)

VMD2L2 antibody (70R-1494) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of VMD2L2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VMD2L2 is 1 of 3 VMD2-like genes which encode transmembrane spanning proteins that share a homology region with a high content of aromatic residues including an invariant arginine (R), phenylalanine (F), and proline (P) motif.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VMD2L2 antibody (70R-1494) | VMD2L2 antibody (70R-1494) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors