VNN3 antibody (70R-6660)

Rabbit polyclonal VNN3 antibody raised against the N terminal of VNN3

Synonyms Polyclonal VNN3 antibody, Anti-VNN3 antibody, VNN-3 antibody, HSA238982 antibody, VNN 3 antibody, VNN3, Vanin 3 antibody, MGC171203 antibody, VNN 3, VNN-3
Specificity VNN3 antibody was raised against the N terminal of VNN3
Cross Reactivity Human
Applications WB
Immunogen VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY
Assay Information VNN3 Blocking Peptide, catalog no. 33R-9602, is also available for use as a blocking control in assays to test for specificity of this VNN3 antibody

Images

Western Blot analysis using VNN3 antibody (70R-6660)

VNN3 antibody (70R-6660) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VNN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VNN3 antibody (70R-6660) | VNN3 antibody (70R-6660) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors