VPREB1 antibody (70R-5905)

Rabbit polyclonal VPREB1 antibody raised against the middle region of VPREB1

Synonyms Polyclonal VPREB1 antibody, Anti-VPREB1 antibody, VPREB 1, Pre-B Lymphocyte Gene 1 antibody, VPREB-1 antibody, VPREB 1 antibody, IGVPB antibody, IGI antibody, VPREB-1, VPREB antibody, VPREB1
Specificity VPREB1 antibody was raised against the middle region of VPREB1
Cross Reactivity Human,Mouse
Applications WB
Immunogen VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP
Assay Information VPREB1 Blocking Peptide, catalog no. 33R-9127, is also available for use as a blocking control in assays to test for specificity of this VPREB1 antibody

Images

Western Blot analysis using VPREB1 antibody (70R-5905)

VPREB1 antibody (70R-5905) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPREB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VPREB1 belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VPREB1 antibody (70R-5905) | VPREB1 antibody (70R-5905) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors