VPS26B antibody (70R-3440)

Rabbit polyclonal VPS26B antibody

Synonyms Polyclonal VPS26B antibody, Anti-VPS26B antibody, VPSB-26 antibody, Vacuolar Protein Sorting 26 Homolog B antibody, VPS26B, MGC10485 antibody, VPSB-26, VPSB 26 antibody, Pep8b antibody, VPSB 26
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen VPS26B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
Assay Information VPS26B Blocking Peptide, catalog no. 33R-1235, is also available for use as a blocking control in assays to test for specificity of this VPS26B antibody

Images

Western Blot analysis using VPS26B antibody (70R-3440)

VPS26B antibody (70R-3440) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS26B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VPS26B belongs to the VPS26 family. VPS26B is probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VPS26B antibody (70R-3440) | VPS26B antibody (70R-3440) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors