VPS37C antibody (70R-3338)

Rabbit polyclonal VPS37C antibody

Synonyms Polyclonal VPS37C antibody, Anti-VPS37C antibody, VPSC-37, VPSC-37 antibody, VPSC 37, VPSC 37 antibody, Vacuolar Protein Sorting 37 Homolog C antibody, FLJ20847 antibody, VPS37C
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen VPS37C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ
Assay Information VPS37C Blocking Peptide, catalog no. 33R-5323, is also available for use as a blocking control in assays to test for specificity of this VPS37C antibody

Images

Western Blot analysis using VPS37C antibody (70R-3338)

VPS37C antibody (70R-3338) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS37C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VPS37C antibody (70R-3338) | VPS37C antibody (70R-3338) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors