VPS53 antibody (70R-3481)

Rabbit polyclonal VPS53 antibody

Synonyms Polyclonal VPS53 antibody, Anti-VPS53 antibody, pp13624 antibody, VPS53, hVps53L antibody, VPS 53, HCCS1 antibody, FLJ10979 antibody, VPS-53, VPS 53 antibody, MGC39512 antibody, Vacuolar Protein Sorting 53 Homolog antibody, VPS-53 antibody
Cross Reactivity Human
Applications WB
Immunogen VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK
Assay Information VPS53 Blocking Peptide, catalog no. 33R-9919, is also available for use as a blocking control in assays to test for specificity of this VPS53 antibody

Images

Western Blot analysis using VPS53 antibody (70R-3481)

VPS53 antibody (70R-3481) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS53 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VPS53 antibody (70R-3481) | VPS53 antibody (70R-3481) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors