VPS54 antibody (70R-4297)

Rabbit polyclonal VPS54 antibody

Synonyms Polyclonal VPS54 antibody, Anti-VPS54 antibody, VPS54L antibody, Vacuolar Protein Sorting 54 Homolog antibody, HCC8 antibody, SLP-8p antibody, VPS54, VPS-54 antibody, hVps54L antibody, VPS 54 antibody, VPS-54, VPS 54
Cross Reactivity Human,Rat
Applications WB
Immunogen VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS
Assay Information VPS54 Blocking Peptide, catalog no. 33R-3011, is also available for use as a blocking control in assays to test for specificity of this VPS54 antibody

Images

Western Blot analysis using VPS54 antibody (70R-4297)

VPS54 antibody (70R-4297) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 107 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS54 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi. This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VPS54 antibody (70R-4297) | VPS54 antibody (70R-4297) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors