VSIG8 antibody (70R-6416)

Rabbit polyclonal VSIG8 antibody raised against the N terminal of VSIG8

Synonyms Polyclonal VSIG8 antibody, Anti-VSIG8 antibody, VSIG 8 antibody, VSIG8, VSIG 8, VSIG-8, VSIG-8 antibody, V-Set And Immunoglobulin Domain Containing 8 antibody
Specificity VSIG8 antibody was raised against the N terminal of VSIG8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
Assay Information VSIG8 Blocking Peptide, catalog no. 33R-3838, is also available for use as a blocking control in assays to test for specificity of this VSIG8 antibody

Images

Western Blot analysis using VSIG8 antibody (70R-6416)

VSIG8 antibody (70R-6416) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VSIG8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VSIG8 antibody (70R-6416) | VSIG8 antibody (70R-6416) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors