VTA1 antibody (70R-3837)

Rabbit polyclonal VTA1 antibody

Synonyms Polyclonal VTA1 antibody, Anti-VTA1 antibody, DRG1 antibody, VTA-1 antibody, FLJ27228 antibody, LIP5 antibody, Vps20-Associated 1 Homolog antibody, C6orf55 antibody, VTA 1 antibody, VTA-1, VTA1, HSPC228 antibody, VTA 1, DRG-1 antibody, My012 antibody, SBP1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
Assay Information VTA1 Blocking Peptide, catalog no. 33R-4488, is also available for use as a blocking control in assays to test for specificity of this VTA1 antibody

Images

Western Blot analysis using VTA1 antibody (70R-3837)

VTA1 antibody (70R-3837) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VTA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VTA1 antibody (70R-3837) | VTA1 antibody (70R-3837) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors