VTI1A antibody (70R-6971)

Rabbit polyclonal VTI1A antibody

Synonyms Polyclonal VTI1A antibody, Anti-VTI1A antibody, VTIA-1 antibody, Vti1-rp2 antibody, VTIA-1, MVti1 antibody, VTI1A, Vesicle Transport Through Interaction With T-Snares Homolog 1A antibody, VTIA 1 antibody, VTIA 1
Cross Reactivity Human,Mouse
Applications WB
Immunogen VTI1A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL
Assay Information VTI1A Blocking Peptide, catalog no. 33R-8790, is also available for use as a blocking control in assays to test for specificity of this VTI1A antibody

Images

Western Blot analysis using VTI1A antibody (70R-6971)

VTI1A antibody (70R-6971) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VTI1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VTI1A is a V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. VTI1A may be concerned with increased secretion of cytokines associated with cellular senescence.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VTI1A antibody (70R-6971) | VTI1A antibody (70R-6971) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors