WARS antibody (70R-2448)

Rabbit polyclonal WARS antibody raised against the N terminal of WARS

Synonyms Polyclonal WARS antibody, Anti-WARS antibody, Tryptophanyl tRNA Synthetase antibody, IFP53 antibody, IFI53 antibody, GAMMA-2 antibody
Specificity WARS antibody was raised against the N terminal of WARS
Cross Reactivity Human
Applications WB
Immunogen WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF
Assay Information WARS Blocking Peptide, catalog no. 33R-2465, is also available for use as a blocking control in assays to test for specificity of this WARS antibody

Images

Western Blot analysis using WARS antibody (70R-2448)

WARS antibody (70R-2448) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WARS antibody (70R-2448) | WARS antibody (70R-2448) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors