WDR1 antibody (70R-3385)

Rabbit polyclonal WDR1 antibody raised against the N terminal of WDR1

Synonyms Polyclonal WDR1 antibody, Anti-WDR1 antibody, WDR-1, WDR 1 antibody, WDR 1, AIP1 antibody, NORI-1 antibody, Wd Repeat Domain 1 antibody, WDR1, WDR-1 antibody
Specificity WDR1 antibody was raised against the N terminal of WDR1
Cross Reactivity Human
Applications WB
Immunogen WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ
Assay Information WDR1 Blocking Peptide, catalog no. 33R-1988, is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody

Images

Western Blot analysis using WDR1 antibody (70R-3385)

WDR1 antibody (70R-3385) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR1 antibody (70R-3385) | WDR1 antibody (70R-3385) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors