WDR21A antibody (70R-3466)

Rabbit polyclonal WDR21A antibody raised against the middle region of WDR21A

Synonyms Polyclonal WDR21A antibody, Anti-WDR21A antibody, WDR21, MGC20547 antibody, WDR-21 antibody, Wd Repeat Domain 21A antibody, DKFZp434K114 antibody, WDR-21, MGC46524 antibody, WDR21 antibody, WDR 21, WDR 21 antibody
Specificity WDR21A antibody was raised against the middle region of WDR21A
Cross Reactivity Human
Applications WB
Immunogen WDR21A antibody was raised using the middle region of WDR21A corresponding to a region with amino acids ARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS
Assay Information WDR21A Blocking Peptide, catalog no. 33R-1483, is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody

Images

Western Blot analysis using WDR21A antibody (70R-3466)

WDR21A antibody (70R-3466) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR21A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR21A antibody (70R-3466) | WDR21A antibody (70R-3466) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors